PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_73300.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HSF
Protein Properties Length: 132aa    MW: 14581.6 Da    PI: 8.0636
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_73300.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind735.7e-231573260
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                  F+ k+y+++ed+ ++ +i w + +nsfvv d+  f++++Lp +Fkh+nf+SFvRQLn+Y
  MLOC_73300.2 15 FVWKTYRMVEDPGTDGVIGWGKGNNSFVVADPFVFSQTMLPAHFKHNNFSSFVRQLNTY 73
                  9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.3E-251175IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.9E-211195IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.17E-221473IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.1E-181573IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.4E-131538IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.4E-135365IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.4E-136678IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MAAAAASVGG GAAPFVWKTY RMVEDPGTDG VIGWGKGNNS FVVADPFVFS QTMLPAHFKH  60
NNFSSFVRQL NTYVSPLIHI TNPPFVLSIS CTYLDSERER EREISVLRWS TSSYVRVCTT  120
VYAVCVTFFG SI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5x_E6e-171273162Putative transcription factor
5d5x_B6e-171273162Putative transcription factor
5d5w_B6e-171273162Putative transcription factor
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2485381e-119AK248538.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf61l22, mRNA sequence.
GenBankAK3544351e-119AK354435.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1007F06.
GenBankAK3581361e-119AK358136.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1069K14.
GenBankAK3703991e-119AK370399.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2110B13.
GenBankHM4460411e-119HM446041.1 Hordeum vulgare subsp. vulgare heat shock factor C2b (HsfC2b) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0YV275e-95M0YV27_HORVD; Uncharacterized protein
STRINGMLOC_73300.11e-46(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.15e-25heat shock transcription factor C1